PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G121800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 622aa    MW: 65330.2 Da    PI: 4.8427
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G121800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4654.3e-1422386171374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevs 88 
                         lv++Ll+cAeav+++++++a+al++++  las++g +m+++aayf eALa+r++r        ++p ++s  +  ++++a+ l   f+e +
  Sevir.9G121800.1.p 238 LVHALLACAEAVQQENFAAAEALVKQIPMLASSQGGAMRKVAAYFGEALARRVYR--------FRPAPDS--SLLDAAFADLLhahFYESC 318
                         689****************************************************........4444443..34444444433445***** PP

                GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                         P+lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++
  Sevir.9G121800.1.p 319 PYLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYR 409
                         ******************************************************************************************* PP

                GRAS 180 vlvakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                          lva +l+dle+ +L+ +        E++aVn+v++lhrll+++++le+    vL +v+ ++P++v+vveqea+hns+sFl+rf+e+l+yy
  Sevir.9G121800.1.p 410 GLVAATLADLEPFMLQPDGedtddePEVIAVNSVFELHRLLAQPGALEK----VLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYY 496
                         ***************65544556689***********************....************************************** PP

                GRAS 265 salfdsleak.........lpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                         s++fdsle            p+ +  +++++++++lgr+i+nvvaceg+er+erhetl++Wr+rl++aGF+pv+l+++a+kqa++ll+ ++
  Sevir.9G121800.1.p 497 STMFDSLEGAgsgnsaadaSPAPAgGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRLGRAGFEPVHLGSNAYKQASTLLALFA 587
                         *******87767777666533333799**************************************************************** PP

                GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +dgyrvee++g+l+lgW++rpL+++SaWr
  Sevir.9G121800.1.p 588 gGDGYRVEEKDGCLTLGWHTRPLIATSAWR 617
                         *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.5E-3637110IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011298.6E-3337116No hitNo description
PROSITE profilePS5098568.326212596IPR005202Transcription factor GRAS
PfamPF035141.5E-139238617IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MKREYQDAGG SGGDMGSSKD KMMAAVAGAG EQDEEVDELL AALGYKVRSS DMADVAQKLE  60
QLEMAMGMGG AGAAADDGFV SHLATDTVHY NPSDLSSWVE SMLSELNAPP PPLPPAPPAP  120
RLASTSSTVT GGAAAGGVYF DLPPAVDSSS STYALKPIPS PAAASADPST DSAREPKRMR  180
TGGGSTSSSS SSSSSLDGGR TRSSVVEAAP PAAQASAAAS GPAVPVVVVD TQEAGIRLVH  240
ALLACAEAVQ QENFAAAEAL VKQIPMLASS QGGAMRKVAA YFGEALARRV YRFRPAPDSS  300
LLDAAFADLL HAHFYESCPY LKFAHFTANQ AILEAFAGCR RVHVVDFGIK QGMQWPALLQ  360
ALALRPGGPP SFRLTGVGPP QPDETDALQQ VGWKLAQFAH TIRVDFQYRG LVAATLADLE  420
PFMLQPDGED TDDEPEVIAV NSVFELHRLL AQPGALEKVL GTVRAVRPRI VTVVEQEANH  480
NSGSFLDRFT ESLHYYSTMF DSLEGAGSGN SAADASPAPA GGTDQVMSEV YLGRQICNVV  540
ACEGTERTER HETLGQWRNR LGRAGFEPVH LGSNAYKQAS TLLALFAGGD GYRVEEKDGC  600
LTLGWHTRPL IATSAWRAAA P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-592386174375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2425300.0AJ242530.1 Zea mays partial d8 gene for gibberellin response modulator.
GenBankBT0542620.0BT054262.1 Zea mays full-length cDNA clone ZM_BFb0203D23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982031.10.0PREDICTED: DELLA protein DWARF8
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLK4AKH70.0K4AKH7_SETIT; Uncharacterized protein
STRINGSi039400m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein